SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87238 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87238
Domain Number - Region: 193-218
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0207
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87238
Sequence length 228
Comment (Physcomitrella patens)
Sequence
MELNHVSEKKMVELFGLAMIPEIREYITLIMDHYENSWEIFLRALKDEYFLEDTDRVTKK
LFLEWIEQPNKNLQATELLTEFERHYSQLSKLLLEDTEEDEGLTTKWKNVESAVGLLAKR
KKRKDWSNILKAIQAPKILVHTTQLMMRAIQPSTSLPKKGDMGMKEIIQGMRDLQIKLAR
LEENTSTNNLKNVSKQGYVQRCIWCDDASHAKKDCDEFNNMIRQEVIC
Download sequence
Identical sequences A9T2J7
jgi|Phypa1_1|87238|fgenesh1_pg.scaffold_155000058 3218.JGI87238 XP_001772839.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]