SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87255 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87255
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00863
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 230-335
Classification Level Classification E-value
Superfamily YwmB-like 0.0275
Family YwmB-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87255
Sequence length 369
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLTSLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETV
ARESASYGARVDDEIGGSTKTSEFWASAVSTMQEGKLSREALSRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAQEAASQELPVKDISASL
GEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEEPILNAKVEFTLKEVLGIAKKESHDVI
IDSIKRKRQLMSETGMSHAIDARICRDEEEVDIGYKQPINEKNGYNQRVRFEDSSDKEMG
TLSHYTRKH
Download sequence
Identical sequences jgi|Phypa1_1|87255|fgenesh1_pg.scaffold_156000004 3218.JGI87255 XP_001772848.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]