SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87259
Domain Number - Region: 230-268
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0144
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 402-506
Classification Level Classification E-value
Superfamily YwmB-like 0.0798
Family YwmB-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87259
Sequence length 540
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPSQGTLFSVNGFLKGKNRGESLAARANFESKLRTVSGYKISF
IFQHSKTDRLLDYRRISILPSTARRPTHSRAGKHDFWEKFLVGSLLKDKPNKVDLFLQAA
DGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRT
TPPTMPTVQPSTSLSKKADMEMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRC
IWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKG
HETVVRESASYGARLDDEIGGSTKTRKLSREALSRTAATIRGRTGWEDPVESLSVHAYIA
KSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDISASLEEKTTETKD
KGKSIAYKLLSDIEAATNLKGVLEEPILNAKVEFTLKEVLGIAKKESHDVIIDSIKRKRQ
LMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKH
Download sequence
Identical sequences 3218.JGI87259 XP_001772851.1.60028 jgi|Phypa1_1|87259|fgenesh1_pg.scaffold_156000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]