SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI87410
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87410
Sequence length 156
Comment (Physcomitrella patens)
Sequence
MEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQVLGKCTFCGGKHLTA
NCWNLQRQQQFSNPTMIPPTPWDVNQVQTGNTFGWHGNRSNRQNRAVNHFQNSTYSEGFV
SNPRNYDPESRKNGGNKSRTSRLSSKSGGMCPYRSY
Download sequence
Identical sequences A9T304
3218.JGI87410 XP_001772957.1.60028 jgi|Phypa1_1|87410|fgenesh1_pg.scaffold_157000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]