SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87427 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87427
Domain Number - Region: 193-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00471
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87427
Sequence length 321
Comment (Physcomitrella patens)
Sequence
MWSRLRGFDSVSGCPVLCAVSGNVVYDVDRITKKLFWEWIKRPDKNLQATELLREFERQY
SQLSKVEKLTLELNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTK
KERRKDRSNIPKTVQAPKAPVRTIPPTMPTIQPSTSLSKKADMGREEIIRGMRDLQIKLA
RLEENTSIKNSKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIWQGIICWKDGKIALKDR
EDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDAIGGSTETSLTTGLSQSDVK
TNLTQLLEHPGYYGHLTQYGT
Download sequence
Identical sequences A9T320
3218.JGI87427 jgi|Phypa1_1|87427|fgenesh1_pg.scaffold_157000064 XP_001773010.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]