SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87431
Domain Number - Region: 523-618
Classification Level Classification E-value
Superfamily Acid proteases 0.00216
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number - Region: 278-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87431
Sequence length 867
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQSDGRNISRYLRCHVHEME
LNRVSEKKMVAIFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKKLF
LGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQDKLKPLLE
DKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPIRTTPPTMPAIQPSTS
LSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGFVQRCIWCDDASHTRKDC
NEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKAGMRALVQDYLKEHETAAQESTSYGA
RVDDEIGGSTETTSQELPVKDTSASLGEKTTVTKDKNKSIAYKLLSDIEAATNLKGVLEE
RILNAKMEFTLKEVLGIAKKEFHDVIIDSIKRKKQLMSETGMSHANDARICRDEEEVDIG
YKQPTNEKNGYNQRVHFEDSSDREMKTLSHYTRKHWARATTEVLVKVEDIEEPIVALVDH
GSEINLMSKDLYKKQKWPIDMEHGWAIQAANNTRGELYEACPDVKIWIGDVATEQHFFVQ
DTTSYPLILGQPYITATRMETKVLYDGSAYARARSKDGRKAVQFLTVPPNHERNRDRLRE
KPLPKIRDYGGTKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKKKERKRLYDIEGQL
CKIGTLQDDERILDVYEENGLEDSLELITSIGLGDNDKIIEIHSREVYTMLESFQAPEVT
VETRYKTVDKKVKPVTGPLSEDSKEQMGEASKEASLRDSMSIGHQFTEETFEELKIGSDE
IPQQEDESDMDNEGDEDKLEKDVGDIF
Download sequence
Identical sequences A9T324
3218.JGI87431 jgi|Phypa1_1|87431|fgenesh1_pg.scaffold_157000068 XP_001772968.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]