SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87437
Domain Number - Region: 391-432
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00046
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87437
Sequence length 768
Comment (Physcomitrella patens)
Sequence
MFPKTRSQKPTLNQGLEHIGRRGGKVVDNKEATPSRNTLINSRSNEEFLGGDIRRNLEKA
LGDVGGSELLEELEVEELEIEHVDPEDRVFGDVNLREIGEQDRTLDFVPVVEGFVHEMAT
ERLPALDPLVRPRGLPVAMPAELLAATVSRNLFKFYGTKDEDSTLHMERYIEILTISLIG
NEGYYLVWFSETLHGEAYNWYQDHDEGHFTTWSQLQVAFLNHFRPEVGQSTALKALGAVR
QQRDKEMANYIRRFDLVCMRYVGGLLNGDTLKQFFIEGFANRSTIKGVLERNPATLEEAK
TAARVVDLIERIGPSTSSTPPIVDNDAQYYNVMPTATRAPIPLLALPEPQLERRVEDLEK
KIQAGQEGFQDSMMKQIRALIEQMAFMVKNQNSNTPPPQIESGNHNSGIWCTTCGQNGHS
SLQCRVRPQGNPNSQLYQPTQGYGRDRGSQQRQGGYQGVPQGYGRSGRPRKEYHELCRRW
HEPDQRRPHGDDQRGLKPPNLYYNYEDFRQNHQPPEELQTRQGYIPVAQNQQGGYRNYAN
QKQGPSSNQDVRVAEEVLLKGPAPSLAKTTVVIEEHEAPSNLVTHELKKDGGGGHKNATL
AVIIRGQAHRQSPIDEEDSNSSESEELLDLVALEAAAKEAARITREVGTAVGDERSSEGS
DPGKGLEPGEWEGPDIPEEEFGGLGRTTPTSYQKYDLWRDLRRIKANISIAQLLEISLLM
RKSFKEGLPRAKRKKKTQKRTVARIQASIRPVDDSRWLTSYLLEKAHH
Download sequence
Identical sequences A9T330
3218.JGI87437 jgi|Phypa1_1|87437|fgenesh1_pg.scaffold_157000074 XP_001773016.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]