SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI87743
Domain Number 1 Region: 352-397
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000023
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87743
Sequence length 463
Comment (Physcomitrella patens)
Sequence
MVNKNESIASKKINQLRERQGRAQGRNLDREEQERNLKRKHRQNWIKPWLQACRRIRTYQ
EPDRLLIVQSYVPLEKLPRALAGNFVNIPVEILRPLTERERGIEVFGTPLGNFRVGGTAE
TSNRGSADWHELVANKGHYIVFQNPMFSPASQPIKLFAGNNSKARTAESSVIRVRESRDY
FKTNFKGTKNSMAAGGPVVPIAVQMGTLGDRTTTVAPLSTFRGLPASLERAKVWEECHYD
QHLTVGATMIPSQGGYQMTNWNDASKSYPGRSDYGTIPQGIMNAVPLQAVLPSSSQPYVP
YSAYQKLIPTKELTNELVSRDPNESLLLTLTKKMDELAMNLAKDKEKRHKPTNMRPNVWC
SNCKEQGHLVTECSSPPQMMVQCTFCGGKHTTANCWNLRKQQQVGQQTMSQPTSWDVNQM
QTSQPAEDKGPVQRDSPVHANFIGERSAYQGPIERQESNSGPG
Download sequence
Identical sequences A9T3W8
3218.JGI87743 jgi|Phypa1_1|87743|fgenesh1_pg.scaffold_161000017 XP_001773294.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]