SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87745 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87745
Domain Number - Region: 274-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87745
Sequence length 691
Comment (Physcomitrella patens)
Sequence
MDPSIASMFQAFSLSMQQQQNNDQKKALATKALQAVVNKIDQFDGRNISRYLRCNVREME
LNQISEKKMVELFRLAMIPEIRDHITLITDRYGNSWEVFLHALKDEYFLEDADHVTKKLF
LEWIEWPNKNLQAIELLREFKRQYSKVEKLTLEPNKVDLFLQAADRELQGKLELLLKDKE
EDEGLTIKWKNIEDAVGLLTKRERRKDRSNILKKVQAPKAPIRTTPPTMPTVQPSTSLSK
KADMGMEEIIRGMRDLQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDNSHTRKDCNEF
NNMIRQGIICWKDGKIALKDREDLLQTNFNKGGMRALVQDYLKEHETRARESASYGARVD
DDLGGSMEIIHAYIAKSQHEALMEEKRRGNFDDTREGNSSKKQTRGNKAQEAASQELPVK
DISASLEEKTRETKDKGKSIAYKLLSDIEASMNLKGVLEERILNAKVEFTLKEVLEIAKK
EFHDVIIDSIKRKRQLMDETGMSHAINARIYKDEEEVDIGDKQPTNEKNGYNQRIRLEDY
WNIEEPIVDLVDHGSEINLMSKDLYKKQKWPIDMEYGWAIRAANNTWGELYGACSDVKIR
IGDVETEQHFFVQDTTSYPLILGQLYITTIRIEKKVLDDGSAYARVRSKDRRKTVQFLTV
PPNHERNRDRLREKPLPKIVEGFKDFREVPL
Download sequence
Identical sequences A9T3X0
3218.JGI87745 XP_001773296.1.60028 jgi|Phypa1_1|87745|fgenesh1_pg.scaffold_161000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]