SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87780
Domain Number - Region: 194-232
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.023
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 32-128
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0432
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87780
Sequence length 783
Comment (Physcomitrella patens)
Sequence
MELNQVSEKKMVALFGLARIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKK
LFLGWIEWPNKNLQATELLREFERQYSQLSKLIYFFEDKEEDEGLTTKWKNVEDAVELLT
KKERRKDRSNIPKIVQAPKAPVRTTPPTMPTVQPSTSLSKKADMSMEEIIRGMRDLQIKL
ARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKD
RKNLLQTNFGKGGMRALVQDYLKEHVIVARESASYGARVDDEIGGSTETSEFWASAVSTM
QEGKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGN
SFKKQTRGDKAREAASQELRLLSDIEAATNLKGVLEERILNAKVEFTFKEVLGIAKKEFH
DVIIDSIKRKRQLISETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDK
GMETLSHYTRKHWARATSEVLVKVGDIEEPIVALVDHDSEINLMSKDLYKKQKWRIDMKH
GWAIRAANNTRGKLYGACPNVKIRIGDVAAEQHFFVQDTTSYPLILGQPYITAIRMETKV
LDDGFAYARVRSEDGRKAVQFLIVPPNHERNRDRKERKRLYDIEGQLRKIGTLQDNERIL
GVYEENGLEDSLELITSIGLVDNDKIVEILSREVYTMLESFQAPEVTVETRYKTADKKVK
PVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFTEETFEELKIGSDGSLLPEEITCFKKM
LAK
Download sequence
Identical sequences A9T403
XP_001773314.1.60028 3218.JGI87780 jgi|Phypa1_1|87780|fgenesh1_pg.scaffold_161000054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]