SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI88209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI88209
Domain Number - Region: 336-371
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI88209
Sequence length 803
Comment (Physcomitrella patens)
Sequence
MQSNYRKIQVVLFSVPFQGTLFLVKESLKGKNRGESSDGFLGGISSGDSSKGQGMHMDPS
IASMFQAFSLSMQQQQSNDRQEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNQV
SEKKMVELFGLATMPAIRDHIASITNRYGNSWEVFSHALKDEYFLEDADHVIKKLFLKWI
ERPNKNLQATELLKEFERQYSQLSKVEKLTLEPNKVDLFLQAANGELQGKLELLLEDKEE
VEGLTTKWKNVEDAVGLLIKRERRKDRSNILKIVQASKAPIRTTPPTMPTVQPSTSLSKK
ADMEMEEIIRGMRDLQIKLARLEENTSINNSKNDSKQRYIQRCIWCDDASHTRKDCNEFN
NMIRQGIICWKDGKIALKDREDLLQTNFGKRGMRALVQDYLKEHETAARESASYGARVDD
EIGGSMESTSLEEKTKETKDKGKSIAYKLLSDIEAATNLKGVLEERILNTKVEFTLKEVL
EIAKKEFHDVIIDNIKRKRCRDVATEQHFFIQDTTSYPLILGQPYITATRMETKVLDDGF
AYARVRSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEEVLSRDEGAFDAS
FIGILENGNILYKKVYDFKRKERKRLYDIEGQLRKLGTLLDDERILGVYEENGLEDSLEL
ITSIGLGDHDKIVEIHSREVYTILESFQAPEVTVETRYKTVDKKVKPVAGPLPEDSKEMG
EASKEENLRDPMSIGHQFTKETFEELKIGSDGSLVPEEITCFKKMLAKQGRLFAFECHKI
GCVDPNIITPMVIFTIPHVPWNL
Download sequence
Identical sequences A9T554
jgi|Phypa1_1|88209|fgenesh1_pg.scaffold_166000060 3218.JGI88209 XP_001773746.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]