SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI88306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI88306
Domain Number 1 Region: 138-175
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000153
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI88306
Sequence length 309
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTVSTSLDRAKVWEECHYDQFLTASTTMIPVQSNYQYPALNGSVGSYPQMIE
KVAHSSANTQGPVNVTPLQALPPQVTTAYTPYFPYQIQDSTLAEKQIIQASKDSNEALSL
NLTKKMEEMAINMAKNKEKRQKPTNTRTNIWCSNCQGHGHLVMECPSPSQVLDKYTFYGG
KHLTANCWNLQRQQQFSNPTMILPTPWDVNQIQSPEKMEEINRGPQDSPVNRVECVHTVL
TRSQQKEKGPIKYLEDPKAKGQSHPITDPSHSSTDTGKVPSPDLVVKPNEVPITEFSVPS
RTGLFPPQF
Download sequence
Identical sequences A9T5E8
jgi|Phypa1_1|88306|fgenesh1_pg.scaffold_168000009 XP_001773828.1.60028 3218.JGI88306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]