SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI88569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI88569
Domain Number - Region: 504-600
Classification Level Classification E-value
Superfamily Acid proteases 0.000765
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Domain Number - Region: 209-247
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0249
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI88569
Sequence length 863
Comment (Physcomitrella patens)
Sequence
MKGGELGFEGREYKAVSEISRSGCLGFSVMSRDLSAGAKRISAVLFSVPSQGTLFSVNGF
LKGKNGGESLTARANFGSKLEVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGL
TMKWKNVEDAVGLLTKKERRKDRSNIPKPVQAPKAPVRTTPPIMPTVQPSTSLSKKADMG
MEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIQ
QGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGARVDDEIGG
STETTTIRGRTGWEDPVESLSIHAYIAKSQHEALMEEKRRGNFDDTREGNFSKRQTRGDK
AREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVE
FTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEK
NGDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVVLVDHGSEINLMSKDLYKKQKWPI
DIEHGWAIRAANNTQGKLYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQSYITAIRM
ETKVLDNGSAYARRDYGGTKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKRKERKRL
YDIEGQLRKIGTLQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREVYSMLES
FQAPEVTIETKYKTADKKVKPVAGPLPEDSKEQMGKASKEASLRDPMSIGHQFTEETFEE
LKIDSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGCVDPNIITPMVIFTISHVPWNLRP
IPVPRAHLPKLVELLKEKIKMKI
Download sequence
Identical sequences A9T635
jgi|Phypa1_1|88569|fgenesh1_pg.scaffold_171000045 3218.JGI88569 XP_001774047.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]