SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI88639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI88639
Domain Number 1 Region: 345-392
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000238
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI88639
Sequence length 483
Comment (Physcomitrella patens)
Sequence
MVIKNENLTVKKIRQSRERIERSQARNLLRNEQQRKLKRNHRQSWIKPWLHACRHIRAYP
EANRHLIFQKYIPLEKLSRALAENLINRPGFLLRPLTESGGITEELGTPLGTFPIAETAD
SVKTGSIEWHKLLVNKGQFSVFQNPSFSPPIQPINLFKDNNSKLSRIESSENIFRRDADY
INKRLSVTLSNSMTTGGPAVPIAVQMGTVSDRTTSVALLPTFRGFPGADPDQHLSQFLTA
FQSNYQYPALNGSVGSYPQMIETVAQSSANTQGPVNVTPLQALPPQVTTAYAPYFPYQTH
ESTLAEKQIISASKDSNEALLLNLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGH
GHLVTECPSPSQVLGKCTFCGGKHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTGNTF
GWHGNRSNRQNRAVNHFQNSTYSEGFVSNPRNYDPESWKNGGNKSRTSRLSSKSGGMCPY
RSY
Download sequence
Identical sequences A9T6A0
jgi|Phypa1_1|88639|fgenesh1_pg.scaffold_172000034 3218.JGI88639 XP_001774118.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]