SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI88773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI88773
Domain Number - Region: 304-344
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0139
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI88773
Sequence length 552
Comment (Physcomitrella patens)
Sequence
MENENKNFEGSLGGISSGGSSKGQGMHMDPSIASMFQAFSLSMQQQESNDQKEAFATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRIFEKKMVKLFGLATISKIRDYITSITDCYG
NSLEVFSHALKDEYFLEDADRVTKKLFLEWIERPNKNLLATKLLREFERQYSQLSKVEKL
TLEPNKVDLFLQAADRELQGKLELLLEDKEEDEGLTTKWKNVEDVVELLTKRERRKDRSN
IPKIVQAPKAPIRTILPTMPTVQSSTSLSKKADMEMEEIIRGMRDLQIKLAKLEENTSTN
NSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKDGKIALKDREDLLQTNFG
KGGMRALVQDYLKEHETTARESASYGARVDDDLGRSTETSEFWASAVSTMQEGKLPREAL
LKTAATIRRRTGWEDSVESLSVHAYIAKSQHEALMEEKKRQLMDKTEMSHAIDARIYRDE
EEIDISYKQSTNEKNGYNQRIHFEDSSDKEMETLSHYTRKHWARATTKQEDESDMGNEGD
DDELDKDVGDIF
Download sequence
Identical sequences A9T6M0
jgi|Phypa1_1|88773|fgenesh1_pg.scaffold_174000015 3218.JGI88773 XP_001774280.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]