SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89176
Domain Number - Region: 139-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00034
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89176
Sequence length 361
Comment (Physcomitrella patens)
Sequence
MFVKEAQSTTIESSLEQAKVWEECHYDQNLTIGATMIPSQGGYQMTNWNDASRSYLGKND
YGTILQGIVDVIPLQVVPPSSSHPYVPYSTYQKSIPTKELPNVLVSRDPNESLLLTLTKK
MNELAVNLAKDKEKRYKPTNMRPNAWCSNYKGQGHLVTECPLPPQMTVQCTFCGGKHITT
NCWNLRKQQQLSNQIMTQPTSWDVNQIQSQGKFEEINQGPEDSLGPSNPGPVIGFVSSMR
PDSVAQPNEVPIMEASVPFQAVLFSMQFQEMSYPLKDPLGGGNSKEAPAAISIPNPGEQD
SPKQNQNPVIGTTLSRPTNSGPILESNGAFQYAPADCNGVTEPDHSVFALELVDAPNIRG
N
Download sequence
Identical sequences A9T7P8
3218.JGI89176 jgi|Phypa1_1|89176|fgenesh1_pg.scaffold_179000029 XP_001774640.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]