SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89241
Domain Number - Region: 679-719
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0217
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89241
Sequence length 1068
Comment (Physcomitrella patens)
Sequence
MKQQHDASYGARVDDEIGGSTETSEFWASAIFTMQEGKLPREALLRTAATIRGRTGWEDL
VESLSVHTYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSS
SLGEKTTETKDKGKSIAYKLLSDIKAATNLKGVLGECILNAKVEFTLKEVLEIAKKEFHD
VIIDSIKQKRQLMGETGMSHAIDARICRDEEEVDISYKQPTNEKNGYNQRVHFKDSSDKE
METLSHYTRKHWARATTEVLVKVGDIKEPIVALVDHEQPFITTTRMETKVLDDGSAYARV
RSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEIGTLQDDERILDVYEENG
LEDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVVTRYKRQIRRLVLMVLYCR
RKLLASKRCWLNKQQQSNDQKEALATKALQAVVNKIDQFDGGNISRYLRCYIREMELNQV
FEKKMVELFGLATMPEIRNHITSITDRFGNSWEVFSHALKDEYFLEDVDRVTKKLFLEWI
EWPNKNLQVTELLREFEKQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLELLLEDKEE
DEGLTTKERRKDKSNISKTIQAPKAPVRTTPPTMPTVQPSTSLSKKADMGMEEIIRGIRD
LQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDTSHTRKDCNEFNNMIWQGIICWKDGK
IALKDRKDLLQTNFGKGGMRALVQDYLKEHETAARESASYGARVDDDLGGSMKIRVLEEC
ILNVKVEFTLKEVLEIAKKEFHDVIIDSIKQKRQLMGETGMSHAIDARICRDEEEVDISY
QQPTNEKNGYNQRVHFKDSSDKEMETLIHYTRKHWARATTEVLVKVGDIKEPIVALVDHD
VKIRIGDVATEQHFFVQDTTSYPLILGQPYITTTWLEKKVLDDGSAYARIRSEDGRKAVK
FLTVPSNHERNRDRLREKPLPKIVEGFKDFGEEVLSQDEGAFDASFIGILENGNIMYKKV
DDFKRKERKRLYNIDGELHKFGTQQEDESDLDNDGDEDKLDKDVENIL
Download sequence
Identical sequences A9T7S3
jgi|Phypa1_1|89241|fgenesh1_pg.scaffold_180000050 XP_001774710.1.60028 3218.JGI89241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]