SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89243
Domain Number - Region: 58-96
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00015
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89243
Sequence length 201
Comment (Physcomitrella patens)
Sequence
MPSNETTTYAPYFSYQQQALTAAELPIIPAPKDSNEALLLNLTKKIEEMAVNMSKDKEKR
QKPTNTRTNVWYNNCKGHGHLVTECPSSSQMMGQYQQIQNQGKIVEINQGPQDSSVNRVE
CIQAVLTRSQKKGKGPIQHLGELDAKGQINPIIGTSNLGPVTDLLPNIEPDSIGLPNEEL
ITEALIPFQAIPLSCCNTSIQ
Download sequence
Identical sequences A9T7S5
3218.JGI89243 XP_001774671.1.60028 jgi|Phypa1_1|89243|fgenesh1_pg.scaffold_180000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]