SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI89298
Domain Number 1 Region: 89-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000398
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89298
Sequence length 248
Comment (Physcomitrella patens)
Sequence
MDSYSWMLETVANFNANIQGSINVTPLQAIPPNVTTAYAPYFPYQQQATELLIIQAPKDS
NEALLLNLTKKMEEMVVNMAKDKEKKYKPTNIRTNVWCNNCKDHGHLVIECPSPIQMVDQ
CIFYGGKHLTTNCWNWQRQQQFSNQTMIPLTQWDVNQIQNQGKMEEINQGSQDFLINRLE
CVQAVLTKSQQKVKRPIQHLGDPEAKGQLDPITGPSNLGLHMGPLYSIRSKLVVHPNEVL
IIEAWILF
Download sequence
Identical sequences A9T813
3218.JGI89298 jgi|Phypa1_1|89298|fgenesh1_pg.scaffold_181000026 XP_001774777.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]