SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89419
Domain Number - Region: 327-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.011
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 139-256
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0667
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89419
Sequence length 432
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPSQGTLFSVNGFLKGFLGEVSGGESSKGQGMHMDPSIASLFQ
AFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMV
ALFGLATIPEIRDHITITDRCGNSWEDFSHALKDEYFLEDADRVTKKLFLGWIEWPNKNL
QATELLRKFERQYSQLLKVEKLTLEPNKVDLFLQATDGELQEKLEPLLEDKEEDEGLTTK
WKNVEDAVRLLTKKERRKDRSNILKPVQAPKAPVRTTPSTMPTVQPSTSLSKKADMGMEE
IIRGMRDLQIKLARLEENTSINNSKNVLKQRYVQRCIWCDDASHTRKDCNEFNNMILQGI
ICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGARVDDEIGGSTK
TSEFWASTVSTM
Download sequence
Identical sequences A9T8C3
jgi|Phypa1_1|89419|fgenesh1_pg.scaffold_183000007 3218.JGI89419 XP_001774856.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]