SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89429 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI89429
Domain Number 1 Region: 186-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89429
Sequence length 279
Comment (Physcomitrella patens)
Sequence
MASGGVPSVPTGPPVPPIGPIGPAVRISVPMGQVGDRTTSTAPLPIFSGWPVALSLVRAK
VWEECHYDRILNSNPILIPTQGSSKFPNWSNLANSITGAMAPVTHSTVPIQGVLNPVPLQ
AVPSPMASTYPQFASYQSPGVNTQELPMLPGSKETNKTLLLNLTKKMEELAVNMAKEKEK
RPKQTNFRANVWCTNCKGQGHMVQDCPSPGNMKIQCMNCGGKHPTNNYWYLSNPHFNNTM
SPPMSWDVNQIQGSNGNGWNGSNSKFPRGYQSSSSRLSS
Download sequence
Identical sequences A9T8D2
3218.JGI89429 XP_001774861.1.60028 jgi|Phypa1_1|89429|fgenesh1_pg.scaffold_183000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]