SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89480 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89480
Domain Number - Region: 277-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0238
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 584-673
Classification Level Classification E-value
Superfamily Acid proteases 0.0295
Family Retroviral protease (retropepsin) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89480
Sequence length 770
Comment (Physcomitrella patens)
Sequence
MDPSIASMFQAFSLSMQLQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVHEME
LNQIAEKKMVELFGVATISEITDHITSTTDRYGNSWAVFSHALKDKYFLEDADRVTKKLF
LEWIERPNKNLQATKLLREFERQYSQLSKVEKLTLELNNVDLFFQAANRELQEKLELLLE
DKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKIVQVPKALVRTTPPTMPTVQPSTT
LSKKADMGMEEIIRGMRDLQIKLARLEENTSTKNSKNVSKQGYVQRCIWCDDASHTRKDC
NEFNNIIRQGIICWKDGKIALKNREDLLQINFGKGRMREFVQDYLKEHEIAARESASYGA
RVDDEIGGSTETSEFWTSVVSTMQEGKLPREALLRTAATIRGRTSWEDSVESLSVHTYIA
KSQHEALMKEKRQGNFDDTREGNSSKKKIPGDKAREAASQELPLLSDIEAATNLKGVLEE
RILNAKVEFTLKEVLKIAKKEFHDVIIDSIKRKRQLMGETEMSHAIDARIYKEEEEVDIG
YKKPTNEKNEYNQRVRFENSSEKEMETLSHYTRKHWARATTKVLVKVGDIEEPIVALVDH
GSKINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDIKIRIGDVATEQHFFVQ
DTTSYPLILGQPYIMATRMETKILDDGSPKQGYRDYGGTKEEVLSRDEGAFDASFIGILE
NGNIMYKKVDDFKRKERKRLYDIEGQLRKLGTLQDDERILGVYEENGLED
Download sequence
Identical sequences A9T8I0
XP_001774888.1.60028 3218.JGI89480 jgi|Phypa1_1|89480|fgenesh1_pg.scaffold_183000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]