SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89546
Domain Number - Region: 241-279
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0259
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89546
Sequence length 582
Comment (Physcomitrella patens)
Sequence
MRPDLVGQLNAIQLWEHPGLTTGLLANMRPELVGRLNVVSITGVPIPFQAVPSFMPFRER
SLEGVFGGGSSKGQDADRVTKKLFLKWIERPNKNLQATELLRKFKRQYSQLSKVEKLTLE
PNKIDLFLQAADGELQGKLELFLEDKKKDEGLTTKWKNVEDAVGLLTKRERRKDRSNIPK
TVQAPKAPVCTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTNNLK
NISKQGYVQRCIWCDDASHARKDCNEFNNMIRQGIICWKVRKIALKDREDLLQTNFGKGG
MRVLVQDYLKERETATRESASYGARVDDDLGGRTKTRKLPREALLRTAATIRGTTDWKDP
VESLLVHAYIAKNQHEALMEEKRRGNFDDMREGNFSKRQTRGDKAREAASQELPIKNTSA
SLEEKTRETKDKDKSIAYKLLSDIEAATNLKGVLEEHILNAKVEFTLKEVLGIAKKKFHD
VIIDSIKRKRQLMDKIGMSHAIDARIYKDEEEVDIGYKQSTNEKNGYNQRVHFEDYSDKE
IKNLSHYTRKHWTRVTTEQEDESDLDYEGDEDELDKDVENLL
Download sequence
Identical sequences A9T8P4
jgi|Phypa1_1|89546|fgenesh1_pg.scaffold_184000059 3218.JGI89546 XP_001774946.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]