SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89689
Domain Number - Region: 305-345
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0241
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89689
Sequence length 902
Comment (Physcomitrella patens)
Sequence
MRPELVGRLNMVPITGFDSVSGCPVLCAVSGNVVFGFLGGVSGGESSKGQGMHMDPSIAS
LFQAFSLSMQQQQSNDRKYLSCYVREMELNRVSEKKMVALFGLATIPEIRDHITSITDRY
GNSWEDFSHALKDEYFLEDADRVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKVEK
LTLEPNKVDLFLQAADGKLQEKLEPLLEDKEEDEGLTTKWKNVEDAVELLTKKERRKDGS
NIPKTIQAPKAPVRTTPPTMPTVQPSTSLSKKADMGMEKIIQGMRDLQIKLARLEENTSI
NNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKDGKIAFKNREDLLQINF
GKGGMRALVQDYLKEYETAARESASYGTRVDDEIGGSTETSEFWASAISTMQQGKLPREV
LLRTAATIRARTSLEDPVESLSVHTYIAKSQHEALMEEKRRGNFDDNREGNSFKRQTRGD
KAREAASQELPVKDTSASLGEKTMETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKV
EFTLKEVLGIAKKEFHDVIIDSIKRKRQIMGEIGMSHAIDTRICRDEEEVDIGYKQPTNE
KNGYNQRVRFENSSDKEMETLSHYTRKYWPRATTEVLVKKQKWPIDMEHRWAIRAANNTR
GELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITATRMETKVLDDGCAYARVR
SEDGRKVVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFREEVLSRDEGAFDASFIGILE
NGNIMYKKVDDFKRKERKRLYNIEGQLRKIGTLQDDERILGVYEENGLEDSLELITSIGL
GDNDKIVEIHSREVYTMLESFQAPEVTVETRYKIADKKQEDESDLDNECDEEELDKYIED
IF
Download sequence
Identical sequences A9T931
3218.JGI89689 XP_001775124.1.60028 jgi|Phypa1_1|89689|fgenesh1_pg.scaffold_186000038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]