SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89883
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00863
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 229-335
Classification Level Classification E-value
Superfamily YwmB-like 0.0111
Family YwmB-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89883
Sequence length 370
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETV
VRESASYGARIDDEIGGSTETSEFWASTVSTMQEGKLPREALLRTAAIIRRRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASL
EEKTTETKDKGKSIAYKLLSDIEAATNLKGVLKERILNAKVEFTLKEVLRIAKKEFHDVI
IDNIKRKRQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSRRYRR
TNSCLGGPWF
Download sequence
Identical sequences A9T9L9
jgi|Phypa1_1|89883|fgenesh1_pg.scaffold_189000044 XP_001775312.1.60028 3218.JGI89883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]