SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI89906
Domain Number 1 Region: 307-344
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000182
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89906
Sequence length 382
Comment (Physcomitrella patens)
Sequence
MSGDYDYDNHRRNQQVKERQEQFYFRNLLRQQQEGIQRKKHRWSWIKPWLHACANIRAYP
SSERSTILHHYIPLEKLPRALVGDTASNEASESSSVIIRSLSTEELNNSDSLQERRVSKY
QIGTKRRIHINIARRPAQAPMAEEAPAVPIAVQMGAIGDRTTSVAPLPTFNGWPELKMFV
KESQPVTVAASLAHAKVWEECHYDQLLMVGTTMIPSVGNQVPMTNTMIGSYPRMIVPSIG
NPNSQGVVNATPLQAIPPVATYPSSMAYRQREVPMNAIINDSNEALLLNLMKKMEELAVH
MTKDKEKRHKSSNMRPNIWCNKCKGQGHFDTECPSPHQKMGQYMYCGGKHNTANCWYLPR
QQTMIQPTVWDVNQVQTGNMGG
Download sequence
Identical sequences A9T9P1
XP_001775363.1.60028 3218.JGI89906 jgi|Phypa1_1|89906|fgenesh1_pg.scaffold_190000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]