SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI89916
Domain Number 1 Region: 141-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000172
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Weak hits

Sequence:  3218.JGI89916
Domain Number - Region: 149-236
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.0549
Family Osmotin, thaumatin-like protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89916
Sequence length 257
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTISASLDRAKVWEECHYDQFLTASATMVPVQINYQYPALNGSVGSYPQMIE
TVAHSSANTQGPVNVIPLQALPPQVTTTYASYFPYQTQESTLIEKQIIPASKDSNEALLL
NLTKKMEEMAVNMAKDKEKRQKPTNIRTNIWCSNCQGHGHLTTECPSPSQVLGKCPDTGK
VLSPDLVAKPNEVPITESSVSSQIGLFPSQFQETSYPFKDPLGKAFQYASADSNGVTALG
HSVFALKLVVAPNIRGN
Download sequence
Identical sequences A9T9Q1
jgi|Phypa1_1|89916|fgenesh1_pg.scaffold_190000013 3218.JGI89916 XP_001775369.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]