SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89949
Domain Number - Region: 430-467
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0445
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 662-699
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0445
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89949
Sequence length 1200
Comment (Physcomitrella patens)
Sequence
MFCYLEYWEQRPSPVQILSGQVQSPRYSQPGHTKMLRSIPITRVSRKRKDQFTRRGTLFS
IKRSLKGKNGGESSDGESQFRIQALMWIQDREYKAVSKISSLGCSGFSVTSRDLPAGTKR
TSASSRRASVYIYGVFLQSFIFQQARFLGGVSAGESSKGQGMHMDLSIASMFQAFSLSMQ
QQQSNDRKKALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSQKKMVELFELAT
IPEIRDNITSIMDRYGNSWEDFSHALKDEYFLKDADRITKKLFLEWIERPNKNLQYSQLS
KVEKLTLKPNKVDLFLQAADGELHGKLELLLEDKEEDEGLTTKWKNVEDAVGLLTKREKR
KDRINIPKTVQAPKAPVRTTPPTMPTVQPSTFLSKKADMGMEEIIRGMRDLQIKLARLEE
NTSINNSKNVSKQEYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLL
QTNFSKGGMRALVQYYLKEHETAARESASYGARVDDEIGGSTETSEFWTSAVSIMQEGKL
PREVLLRTAATIQEYSEHHQELFLPLAKSPNIESPFPNCDTKHIVSHHLFEEEHVVLEDL
HLDCVVLKVVTIVMSRPTVQPSTFLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSK
NVSKQEYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFSKGG
MRALVQYYLKEHETAARESASYGARVDDEIGGSTETSEFWTSAVSIMQEGKLPREVLLRT
AATIQGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDNREGNSFKRQTRGDKARE
AASQELPVKVTSASLGEKTKETKVKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTL
KEVLGIAKKEFHDVIIDSIKRKRDEEEVDIGYKQPTNEKNGYNQRVCFEDSSDKEMETLS
HYTRKHWARATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRA
ANNTRGELYGACPDVKIQIGDVATEQHFFVQDITSYPERGNPLLLKKKQSSDIVSVLLSI
FQGQRLDEGKYTPKGYLDIISQNINNYLKYWEQRPTPVQILSGQVESPHYSQPAHIKMLR
SIPITRVSRKRKDQFSRRGTLFSVKRSLKGKNGGESSDGESQFRIQALTVGANSRSKTED
Download sequence
Identical sequences A9T9T1
3218.JGI89949 XP_001775346.1.60028 jgi|Phypa1_1|89949|fgenesh1_pg.scaffold_190000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]