SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89964
Domain Number - Region: 82-117
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0259
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89964
Sequence length 282
Comment (Physcomitrella patens)
Sequence
MLETGANSNTNIQGPVNVTLLQAIPPNVTIVYTPYFPYQQQVLTMAEIPIIPTLKDSNET
SLLNLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCKGHSHSVTECSSSSQIMDQCTF
YGGKSQQKGKGPIQYLGNPDAKDQFDPIRGPSNPGHVTGFVPNIRPNSVAQPNEVPITEA
SVPFQVVPISMQFRETSYPLKDPLEDENSKEAPVAVPILSLGRKNILPHEILKLDAQVHV
LGEYNKDLLAQLRQESMEGLEDKDLQLESKLVEPITDTVAID
Download sequence
Identical sequences A9T9U8
XP_001775358.1.60028 jgi|Phypa1_1|89964|fgenesh1_pg.scaffold_190000061 3218.JGI89964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]