SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI90068
Domain Number 1 Region: 130-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000488
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  3218.JGI90068
Domain Number - Region: 42-132
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.0207
Family AglA-like glucosidase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90068
Sequence length 199
Comment (Physcomitrella patens)
Sequence
MARSGPKIPIVVQMGDVNDRTMSMVPLPIFRNFLVQGSYLNPTWNGSVDNYPRMLETVAN
SSANIQGPINITPLQAIPPNVTTTYAPYFLYQQQAVELPIISAPKDFNEALFLNMTKKIE
EMAINMANDKKKRHKPTNTRTNVWCSNCNGYGHLVKECFSPSQMMAQCTLYGGKHLTANC
WNWQRQQQFSNQTMIPPTQ
Download sequence
Identical sequences A9TA49
jgi|Phypa1_1|90068|fgenesh1_pg.scaffold_192000022 XP_001775508.1.60028 3218.JGI90068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]