SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90069
Domain Number - Region: 297-336
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00141
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90069
Sequence length 376
Comment (Physcomitrella patens)
Sequence
MPIVRDYKSEDILVEITVIEKLPRTLAGNFVNIPVEILRPLTERERGIEVFGTPLGNFPV
GGTAETSNRGSANWHELVANKGNYIIFQNLTFLPTSQPTKLFAENNNKARTAESSVIRVR
ESRDYFKTNFRGTENSMATGGPAVPIAVQMGTLGDRTTSIIPLPTFRGLTASLERAKVWE
ECHYDQHSTVGATMIPSQGSYQMTNWNDASESYPGRSDYSTIPQGIVNAIPLQAVLPSSS
QPYVPYSVYQKSIPTKELTNELVSRDPNESLLLTLTKKLDELAVNLVKDKEKRHKSTNMR
PNVWCSNYKGQGHLVTECSSPPQMMVLCTFCGDANKPAGGGQRSCSTGLISISRRGGERS
AYQGPTKWQESNSGPG
Download sequence
Identical sequences A9TA50
XP_001775478.1.60028 3218.JGI90069 jgi|Phypa1_1|90069|fgenesh1_pg.scaffold_192000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]