SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90122
Domain Number - Region: 523-621
Classification Level Classification E-value
Superfamily Acid proteases 0.00169
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number - Region: 195-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90122
Sequence length 912
Comment (Physcomitrella patens)
Sequence
MVELFGLATIPQIRDHITSITDRYGNSWEVFSHALKDEYFLEDADRITKKLFLEWIERPN
KNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAANGELQEKLEPFLEDKEEDEGL
TTKEKRKDKSNIPKIVQAPKALVCTTPPTMRTVQPSTSFSKKVDMGMEEIIRGMRDLQIK
LPRPKENTSTNNLKNVSKQRYVQRCIWCDDASHTRKDCNEFNNMIRHGIICWKDRKIALK
DREDLLQTNFGKERMRTLVQDYLKEHETTARESASYGTRVDDDLGGSTKTSEFWASAVST
MQEGKLPQEALLRTAAIIRGRTNWEDPVESLSVHAYIAKNQHEALIEEKRQGNFDDTREE
NSSKRQTRGVKAREAASQELPVKDTSASLGEKTKETKDKGKSIAYKLLSDIEAATNLKGV
LEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMGETGMSHAIDARIYKDEEEV
DMGYKQPTNEKNGYNQRVHFEDSSNKEMETLSHYTRKHWARATIEVLVKVGDIKEPIVAL
VDHGSEINLMSKDLYKTQKWPIDMEHGWAIRAVNNTRGELYGACPYVKIWIGDVVMEQHF
FVQDTTSYPLILGQPYITATRMETKVLDDGSTYARRDYGGTKEKVLSRDEGAFDASFIGI
LENGNIMYKKVDDFKRKERKRLYDIEEQLYKLGTLQDDERILGVYEENGLEDSLELITSI
GLGDNDKIVEIHSREVYTMLESFQAPEVTVETRYKTADKKIKPVAGPLPEDSKEQMGEAS
KEASLRDPMSIEHQFTKETFEELKIGSDGSLLPEEIICFKKMLAKQDRSFAFESHEIGCV
DPNIVTPMVIFTVPHVPWNLRPIPIPRGMLFLIKGSLKGKNGRENSDDEEPIPDPRWKIE
EIQWLGFERGEN
Download sequence
Identical sequences A9TAA3
jgi|Phypa1_1|90122|fgenesh1_pg.scaffold_193000012 3218.JGI90122 XP_001775531.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]