SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI90414
Domain Number 1 Region: 265-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000882
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  3218.JGI90414
Domain Number - Region: 98-158
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0255
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90414
Sequence length 344
Comment (Physcomitrella patens)
Sequence
MQVGQEVAKPKRRLVKKKPLLEEELSLIQVMESEEEAEREQEKFQESLQEIQEPHSDEEE
IEKMVMILMEEKNKEFEKKMEMNQLVIDSLMRENVRRKALLEDQKGKLSSHRAKIDQSKK
WKGREHKRTIRRFLKKIEHWHLANDIESDVDKIRTLSALLERSALDWFDVKIKTNPNYAK
ETTWVGVCEGLIARFENKWQNFIIGLQLLKLRQERGKSSLLKYVGKTSFQGETRPFHGSK
KPPFPNRKFEESTSQVGKLKTKESQGSSTKKAKASSSNVICFKCQQKRHYANECKNEEVP
RKVSELPNASLSNETLEIDCLQVMSLSKKVLVKEGGFSRKTNCH
Download sequence
Identical sequences A9TB16
XP_001775838.1.60028 3218.JGI90414 jgi|Phypa1_1|90414|fgenesh1_pg.scaffold_197000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]