SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90662 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90662
Domain Number - Region: 139-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000107
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90662
Sequence length 218
Comment (Physcomitrella patens)
Sequence
MFVKEVQSATIAASLERAKVWEEYHYDQHLTVGATMIPSQGGYQMTNWNDASESYPGRSD
YGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKPIPTKELTNELVSRDPNESLLLTLTKK
MDELAMNLAKYKEKRHKPTNMRPNVCCSNCKGQGHLVTECSSPPQMMVQCTFCGDVNKPT
DGGQRSCSTRLTSTSPRGGERSAYQGPTKREESNSRPG
Download sequence
Identical sequences A9TBP5
jgi|Phypa1_1|90662|fgenesh1_pg.scaffold_199000079 3218.JGI90662 XP_001776038.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]