SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90813
Domain Number - Region: 217-240
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0497
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90813
Sequence length 423
Comment (Physcomitrella patens)
Sequence
MEGGNLDSASSGVGRRASFGGQGSWEKFSQALKDEFFLENSDRVTKRSFFEWIEKPKKDL
LAIELLREFEKQYFSLSKKERELLDSSKVELFLQAADGKLQDKLEFMLEDKEEDEGLTTN
WERVEDVVRMMTKREKRKDMGGDQRPLQPFKIKVSSIHPTSLIQPSIVTSKKEETGIDEI
IRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHRCMWCDNIDHSRRECEEFTEALC
KGVVFFKDGMMHSKENGEKLETNFGKGGMKLFIGDTFKVQTISSNEASTYWVEADTRRCL
SINLEFPIESSSLWTSAMRYIERRNFTRDDLKHVGNNIRKIIGWDDPVDRLSVHAHIARN
QHEALVEEKRRRNENNEGPSKRITRGEKVRQQKNSIHEETMESISTKEREIKKEKAKALA
YKL
Download sequence
Identical sequences A9TC30
jgi|Phypa1_1|90813|fgenesh1_pg.scaffold_201000075 3218.JGI90813 XP_001776130.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]