SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90859 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI90859
Domain Number 1 Region: 156-188
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000393
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 
Weak hits

Sequence:  3218.JGI90859
Domain Number - Region: 260-361
Classification Level Classification E-value
Superfamily Acid proteases 0.000129
Family Retroviral protease (retropepsin) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90859
Sequence length 367
Comment (Physcomitrella patens)
Sequence
MGQALEWCKAASEDDDYPRGHEGLSLRGLPRPRHVAAVETLARRQRLRDELVFRRKRMES
LFTVKRRIQSRVTELGTPGFLQRVWTVSRSSDRVKQEATRQKYFKRESIPEILDEALALA
NQLMEKSSNSGKGKPNKNKVSKRKFEAEDHKIKKDQVGKDKRSRHDNDTCYRCQQSGHMA
RDCRNETKANSSKDKKVLSTIKEVTLIKFVLSIEPKAKFEEPSVQSLLKQGVQVKKSLHL
RAMVLEGGLEARLNILSHQKELVYLKGKWKHTNISLLLDSRATNSLVSSTCATCLRFKME
PIKEVVKVAFAQGSSLATQIVASLNFEVGDTQVVEDFTVCDLSGVDFVLGNTFLDFYGVE
IRRRPRL
Download sequence
Identical sequences A9TC71
3218.JGI90859 jgi|Phypa1_1|90859|fgenesh1_pg.scaffold_202000037 XP_001776192.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]