SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90893
Domain Number - Region: 195-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0194
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90893
Sequence length 649
Comment (Physcomitrella patens)
Sequence
MVELFGLATIPKIKDHITSITDHYGNSWEVFSHALKDKYFLKDVDRVTKKLFLEWIEWPN
KNLQATEILKEYERQYSQLLKVEKLTLEPNKVDLFLHAADGELQGKLELLLEDKEEDEGL
TTKERRKDRSNILKTLQVPKAPVRTIPPTIPTVQPLTSLLKKADMEMEEIIRGMRDLQIK
LARFEENTSTNNLKNVSKQGYVQRCIWCDNASHTRKDCNEFNNMIRQRIICWKDGKIALK
DREDLLQTNFGKGRMKVLIQDYLKEHETAARESASYGARVDDEIGGSTETRDKAREAASQ
ELPVKDTSVSLREKTKETKDKDKLIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVL
RIAKKEFHDVIIDSIKRKRQLMGKIGMSHAIDARIYKDEKGVDIGYKQPSNEKNGYNQRV
RFKDSSDKEIETLSHYTQKHWARATTKVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQ
KWPIDMEHGWAIRAANNTRGELYGACPDVKIRIGNVATEQHFFVQDTTSYPLILRQPYIT
ATRMETKLLGDGSSYARVWSEDGRKAIQFLTVPPNHEQNRDRLREKPLPKIVEGFKDFGE
VPLQSEIMKVQKRREVYTIVESFQALEVTVETRYKMTDKKVKPVAGSLP
Download sequence
Identical sequences A9TCA3
3218.JGI90893 XP_001776210.1.60028 jgi|Phypa1_1|90893|fgenesh1_pg.scaffold_202000071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]