SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI90896
Domain Number 1 Region: 156-192
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000222
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90896
Sequence length 249
Comment (Physcomitrella patens)
Sequence
MASGGVPSVPTGPPVPPIGPIGPAVPIFVPMGQVGDRTTSIAPLRIFSGWPGSSKFPNWS
NLANSIIGAMAPATHSTVAIQGVLNPVPLQAVPSPMASTYPQFVPYQPPGINTQELPVLP
GSKETNETLLLNLTKKMEELAVNMAKEKEKRPKQTNFRANVWCTNCKGQGHMVQDCPSPG
NMKIQCMNCGGKHPTNNYWYLSNPYFNNTMSLSMSWDVNQIQGSNRNGWNGSNSKFPRGY
QSSSSRLSS
Download sequence
Identical sequences A9TCA6
jgi|Phypa1_1|90896|fgenesh1_pg.scaffold_202000074 3218.JGI90896 XP_001776242.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]