SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90950
Domain Number - Region: 356-447
Classification Level Classification E-value
Superfamily Acid proteases 0.00272
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number - Region: 229-335
Classification Level Classification E-value
Superfamily YwmB-like 0.0131
Family YwmB-like 0.036
Further Details:      
 
Domain Number - Region: 54-78
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90950
Sequence length 618
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLLKKADIGMEEIIREMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DTSHTRKDCNQFNNMIRQGIIRSKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHKTV
VRESASYGARVDDEIGGSTKTSEFWASAVSTMQEGKLPRKAVLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKARKAASQELPIKDTSASL
GEKTTETKDKDKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVI
IDNIKQKRQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRARATTEILVKVG
DIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIQAANNTWGELYGACPDVKIRI
GNVATEQHFFVQDTTSYPLILGQPYITATWMETKRDYRGTKEEVLLRDESAFDASFIGIL
ENGNIMYKKVDDFKRKERKRLYDIEGQLPKIGTLQDDERILGVYEENGLEDSLELITSIG
LGDNDKIVEIHSREVYTMLESFQAPEVTVETRYKTVDKKVKPVAGPLLEDSKEQMGEASK
EAILRDPMSIGHQFTDDF
Download sequence
Identical sequences A9TCG0
XP_001776274.1.60028 3218.JGI90950 jgi|Phypa1_1|90950|fgenesh1_pg.scaffold_203000051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]