SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90951 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90951
Domain Number - Region: 502-587
Classification Level Classification E-value
Superfamily Acid proteases 0.00765
Family Retroviral protease (retropepsin) 0.066
Further Details:      
 
Domain Number - Region: 276-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90951
Sequence length 886
Comment (Physcomitrella patens)
Sequence
MQQQQSNDRKEALATKALQAMVNKIDQFDGRNISRYLRCHVREMELNWVFEKKMVELFGL
AMISEIRDHITSITDRYGNSWEIFSHALKDEYFLEDADRIVGYDNVTKKLFLEWIERLNK
NLQATELLKEFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLELLLEDKEEDEGLT
TKWKNVEDAVGLLTKKERRKDRSNISKTVQAPKAPVRTTPPTMPTVQPSTSLSKKADIGM
EEIIRGMGDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNQFNNMIRQ
GIIRWKDGKIALKNRKDLLQTNFGKGGMRALVQDYLKEHKTAARESASYGARVDDEIGGS
TETSEFWASAVSTMQEGKLPREALLKIAATIRGRTGWEDPVESLSVHAYIAKSQHEALME
EKRRGNFDDTREGNSSKRQTRGDKAREVASQELPIKDTSASLREKTMETKDKGKSIAYKL
LSDIEAATNLKGVLEERDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIQAAN
NTWGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITAIRMETKVLDDCSAYA
RIRSEDGRKAIQFLTVPPNHEQNRDRLREKPLPKIVEGFKDFGGEVLSQDEGAFDASFID
ILENGNIMYKKVDDFKRKERKRLYDIEEQLRKLDTLQDDERILGVYEENGVEDSLELITS
IGLGDNDKIIEIHSREVYTILESFQAPEVTVETRYKTVDKKVKPVAGPLLEDSKEQMGEA
SKETSLRDPMGIRHQFTRETFEELKIGSDGSLLPVEITCFKKILIKQGRSFAFESHEIGY
LEYWEQRPTPVQILSGQVQSLHYRQPGHTEMLHSIPITGVSRKRKD
Download sequence
Identical sequences A9TCG1
XP_001776302.1.60028 3218.JGI90951 jgi|Phypa1_1|90951|fgenesh1_pg.scaffold_203000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]