SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91078
Domain Number - Region: 221-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0593
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91078
Sequence length 373
Comment (Physcomitrella patens)
Sequence
MEGGNSDSASSGVGRRASFGGQGMHFDPNSTSMFEALTLFMQQQEQHVKDHKENMANKAL
QAVVDKIDQFEGKDITKYLRCYKERQLLDPSKVELFLQAADGKLQEKLEFMLEDKEEDEG
LTTNWERVEDAVRTMTKREKRKDMDGNQRPLQPSKIKVSSIHPTSLIQSSMATSKKEEIG
IDEIIRGMRDLQIKFAKLEEKGQSSRISIKQRPRPMAGVVHRCMWCDNIDHLRRECEECT
EILRKGVVFFKDGLIHSKENGEKLETNFGKGGMKLFIVYTFKVQTISSNEASTYWVEADP
SRCLSINLEFLVESSSLWTSAMRYAKRENFTRDDLKRIGNNIRQITRWNDPVDRLSVHAH
IARSQHETLIEEK
Download sequence
Identical sequences A9TCS9
3218.JGI91078 jgi|Phypa1_1|91078|fgenesh1_pg.scaffold_205000038 XP_001776420.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]