SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91461
Domain Number - Region: 804-899
Classification Level Classification E-value
Superfamily Acid proteases 0.00366
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number - Region: 492-530
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91461
Sequence length 910
Comment (Physcomitrella patens)
Sequence
MLSKIVTNIDLDSHSVSYYVLSYSRTCRTSGCRRSTLSRPTNSGLILAKSPIVRPGCPRN
WIKLVLRIRLAEARSLILGKRTRIGFLKLDPIGSSNEVHPSCELVLFLPADSHYSNRMEY
FGMPRLTVTGYLEYWEHRPTPVQILSGQVQSLRYSQPGHTEMLHSIPITGVSRKRRTNSH
DGFEEPIGSNFDNPIRAVLFSVPFQGTLFSVNGFLKGFLGEISGGESSKGQGMHLDPSIA
SLFQAFSLSMQQQQSNDRKEALATKALRCYVREMELNRVSEKKMIALFGLATIPEIRDHI
TSITDRCGNSWEDFSHALKDEYFLEDADRVTKKLFLEWIERPNKNLQATELLREFERQYS
QLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKR
EKRKDRSNILKTVQAPKPPIRTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLAR
LEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKITLKDRE
DLLQTNFGKGGMRSLVQDYLKEHKTVVRESASYGARVDDEIGGSTETSEFWASAISTMQE
GKLPREALLRTAATIRGRTCWEDPVESLSVHAYIAKSQHEALIEEKRRGNFDDTREGNSF
KRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDIEATLKEVLGIAK
KEFHDVIIDSIKRKRQLMGETGMSHAIDARIYRNEEEVDIGYKQPTNEKNGYNQLVRFKD
SSDKEMETLSHYARKHWARATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPI
DMEHGWAIRAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITATRM
ETKVLDDGST
Download sequence
Identical sequences A9TDU1
XP_001776745.1.60028 3218.JGI91461 jgi|Phypa1_1|91461|fgenesh1_pg.scaffold_210000064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]