SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI91493
Domain Number 1 Region: 253-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000921
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91493
Sequence length 345
Comment (Physcomitrella patens)
Sequence
MEDENVTSKWVMRCGVANSASTEMVCNGFEQISHIALSSSKNHLVTAPVLLSSVEDAGYK
FHDGLRQFFCGSSCSLIPVHRRGRATEPTRNGSWHYEHKKQSAISSNHHLRIKRGEETVI
PRGGGSQSAVRFRHEAALAVGMQLPIRGTSGLLRDVEVSCIRRPRLLVHSSVPVEGQSAR
AIGVANWRKHGPESEDPLLCWNTLKNIFKATNGVRALHLSKNLGNIKMAEEDKELIFNTS
RAKMIRGGSANFKAPEYFRTVRRGHCNNCGVRGHFARECVKPPIHQQEQYKSQFRRRSEH
RTQAHALQEETMTEEPMKASEMFEAAMMSTTTTLISTTTTLLVGI
Download sequence
Identical sequences A9TDW8
jgi|Phypa1_1|91493|fgenesh1_pg.scaffold_211000025 3218.JGI91493 XP_001776794.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]