SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91533
Domain Number - Region: 269-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000453
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91533
Sequence length 401
Comment (Physcomitrella patens)
Sequence
MSGDYDYDNHRRNQQVKERHERFYFRNLLRQQQEGIQRKKRRWSWIKLWLHACASIRAYP
SSKRSAILHHYIPLEKLPRALVGDTASNEASESSSVIIRSLSTEELNNSDSLQERRVSKY
QIGTKRRIHINIARRPAQAPMAEEAPAVPIAVQMGAIGDRTTSVALLSTFNRWSGNQVPM
TNTMIGSYRRMIVPSMGNPNSQGVVNATPLQAISPVATYPSPMAYRQPKVSMNATINDSN
EALLLNLTKKMEELVVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDTECPSPHQKMGQC
MYCRGKHNTANCWYLPRQQTMIQPTVWNGPAHDINSANYRRNKQTTGITGTSGGSDSRNI
DKKSTKRQRTNSNIGEIDTSPGQQTNTKICSIIGRSITVTT
Download sequence
Identical sequences A9TE06
3218.JGI91533 jgi|Phypa1_1|91533|fgenesh1_pg.scaffold_211000065 XP_001776845.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]