SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91833
Domain Number - Region: 1004-1041
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0706
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 1940-1978
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0733
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91833
Sequence length 2095
Comment (Physcomitrella patens)
Sequence
MFQAVLFFVPFQGTLFLVKRSFKDSQWIQDREYKAVSKISSLRCSGFSVTSRDLPAGAKR
SSRRSRRTSVKIYDEHQPTPVQILSGQVQSLRYSQPGHTEMLRSIPITGVSKKRRTNSHD
GFEEPIGSNFENPIQAVLFSVPFQGTLFSINGFLKGKNGGESLTARANFGSKLESFGKTE
AIAAEVSVVMSFIFQQSKTDRLLDYRQISILPSTARRLARSRAGKHQQQSNDRKEALATK
ALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATIPEIRDHITSITDR
CWNSWEDFLHALKDEYFLKDVDRVTKKLFLEWIERPNKNLQATKLLRQFERQYSQLSKVE
KLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEHAGIICWKDGKIALK
DREDLLQINFGKGGMSALVQDYLKEHETAARESASYGARVDDEIGGSTETSEFWASAVST
MQEGKLPPEALLRTAATIRGRTEGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTET
KDKGKSIAYKLLSDIEAATNLKGMLEERILNAKVEFTLKEVWGIAKKEFHDIIIDNIKRK
RQLMGKTGMSHAIDARICRDEEEVDIGYKQPENEKNGYNQRVHFKDSSDKEMETLSHYTR
KHSRATTKAVLFSVPFQGTLFSVNGFFKGKNGGESLTTRANFGSKLESFIFQQSKTDRLL
DYRQISILPSTARRSARSRAGKHQQQSNDQKKALVTKALQAMVNKIDQFDGRNISRYLRC
YVCEMELNRVSEKKMVALFGLATISEIRDHITSITDRYGNSWEDFSLALKDEYFLEDIDR
VIKKLFLEWIERPNKNLQATKLLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGKLQGK
LELLLEDKEEDEGLTTKWKNIEDAVGLLTKKERRKDRSNIPKIVQASKAPVRTTPPTMPT
VQPSTSLSKKADMGMDEIIRGMRDLQIKLARLEENTSINDSKNVSKQGYVQRCIWCDDAS
HTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQINFGKGGMRALVQDYLKKHEISARE
SASYGARVDDEIGGSTEISEFWASAISTMQEGKLPREALLRTTEEEKFDDTREGNSFKRQ
TRGDKAPEAASQELPIKDTSASLGEKTKETKDKGKSIAYKLLSDIEAETNLKGEIAKKEF
HDVIIDNIKRKWQLMGETGMSHAIDARIYRDEEEVDFGYKQPTNEKNGYNQRVRFEDYSD
KEMETLSHYIRKHWARTTTEVLVKVGDIDEPIVALVDHGSEINLMFKDLYKKQKWPIDME
HGWAIRAVNNTQGELYGACPDRDYGGTKEEVLSRDEGAFDAIFIGILENGNIMYKKVDDF
KRKERKRLYDIEGQLCKLGTLQDDERILGVYEENGLEDSLELITSIGLGYNNKIVEIHSR
EVYTILESFEVQEVTVETTYKTANKKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGF
DGSLLSEEITCFKKMLAKQGRSFAFESHEIGYLEYWEHQPTPMQILSGQVQSLRYSQSRH
TEMLHSIPITGVSKKRRTNSHDRFEEPIGSNFENPIQGTLFAVNRSLKGKNRGEGLDDRP
TGGDKKDFDKQSKSICIDLRYIVAVVYIPAVKTHRLLDYLQISILPSTARRPTRSRAGKH
QQQSNDRKEALATKALQAMVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLAT
ISEIRDHITSITDRYGNSWEDFSHALKDEYFLEDVDCVTKKLFLEWIERPNKNLQATELL
REFQRQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEH
AVGLLTKKERRKDRSNILKIVQASKALVRTTPPTMPTVQPSTSLSKKADMGMEEIIRGMR
DLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDG
KIALKDREDLLQINFGKGGMSVLVQDYLKEHETAARESASYGARVDDEIGGSTETSEFWA
SAVSTMQEGELPPEALLRTAATIRGRTGWKDPVESLSVHAYIAKSQHEALMEEKR
Download sequence
Identical sequences A9TEU0
jgi|Phypa1_1|91833|fgenesh1_pg.scaffold_215000063 3218.JGI91833 XP_001777093.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]