SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91841
Domain Number - Region: 105-150
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0439
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91841
Sequence length 249
Comment (Physcomitrella patens)
Sequence
MTSRGPAILIAVQMGAVGDRTTSVALLPTFRGLPVDVVLLQAVPPSSSHPYAPYSMYQKP
IPRKKLPNALISRDPNESLLLTLTKKMDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQG
HLVTQYLSPPQLTVQYTFCGGKHITINCWNLRKQQQLSNQIMTQPTSWDVNQDQQMQTSQ
PVEDKGPVQRDSPVHRIKVVNVVLTKGQQKDKNLFQNMDEPIAGEQVVLSTGLNKPILVL
EHIPILRPQ
Download sequence
Identical sequences A9TEU8
XP_001777132.1.60028 jgi|Phypa1_1|91841|fgenesh1_pg.scaffold_216000002 3218.JGI91841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]