SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI91860
Domain Number 1 Region: 125-156
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000586
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91860
Sequence length 248
Comment (Physcomitrella patens)
Sequence
MVEALLARVKVWEECHFDQLLTMGATMIPSSGSQQIQLKNVLMDNYPQMASSNMKNVMLQ
QRINATPLQPIAPITMTPYFTSPTYQQLELFTNAAVKDPNEALLLNLTKKMEELAVNLAK
DKEKRHKPSNTRPNVWCNNCKGQGYFDTECPSPRQMGVQSKGQLDPIMGTSNPGLDMGPL
FNIRPELVMHSNEISIMEASILFQAVLFSTQFRETSFLLKDPLRGMNLKESISVQLREQS
YPLKEPIL
Download sequence
Identical sequences A9TEW7
XP_001777142.1.60028 jgi|Phypa1_1|91860|fgenesh1_pg.scaffold_216000021 3218.JGI91860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]