SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91899
Domain Number - Region: 528-621
Classification Level Classification E-value
Superfamily Acid proteases 0.00347
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Domain Number - Region: 209-247
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91899
Sequence length 953
Comment (Physcomitrella patens)
Sequence
MVALFGLATILEIRDHITSITDRCGNSWENFSHALKDEYFLEDADRVTKKLFLEWIERPN
KNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGL
TTKWKNVEDAVELLTKKERRKDRSNIPKPVQAPKAPVRTTPPTMPTVQPSTSLSKKADMG
IEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEVNNMIR
QGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGARVDDEIGG
STETRKLPREALLRTAATIRGRTGWEDLVESLSVHAYIAKSQHEALMEEKRRGNFDDTRE
GNSFKRQTRGDKAWEAASQELPVKDTSASLGEKTMETKDKGKSIAYKLLSDIEAATNLKG
VLEERILNAKVEFTLKEVLGIAKKEFHDVIIDRIKRKRQLMSETGMSHAIDARICRDEEE
VDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVA
LVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANHTRGELYGACPDVKIRIGDVATEQH
FFVQDTTSYPLILGQPYITTTRMETKVLDDGSAYARVRSEDERKAVQFLTVPPNHERNRD
RLREKPLPKIVEGFKDFGEEVLSRDGGAFDASFIGILENGNIMYKKVDDFKRKERKRLYD
IERQLRKIGTLQDDERILGVYKENGLEDSLELITSIGLGNNDKIVEIHSREVYTMLESFQ
APEVTVETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFTEETFEELK
IGSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGCVDPNIITPMVIFTVPHVPWNLRPIP
VPRAVLFSVPSQGTLFSVNGFLKGKNGGESLTARANFGSKLKVGANSGSKTED
Download sequence
Identical sequences A9TF04
3218.JGI91899 jgi|Phypa1_1|91899|fgenesh1_pg.scaffold_217000017 XP_001777212.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]