SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91945
Domain Number - Region: 147-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000392
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91945
Sequence length 222
Comment (Physcomitrella patens)
Sequence
MFVKEAQSATIASSLERAKVWEECHYDQNLIVGATMILSQGGYQMTNWNDASGSYLGRND
YGTIPQGIVDAVPLQAIPPSSSHLYASYFAYQKSIPTKKLPNALLSRNSNESLLLIFTKK
MDELAVNLAKDKEKRHKPTNMRPNIWYSNCKGQGHLVTECPSPSQMIVQCTFCGGKHITT
NCWNLRKQQQLNNQIVTQPIQWDINQVQTENRFGWNGNRANK
Download sequence
Identical sequences A9TF47
XP_001777234.1.60028 3218.JGI91945 jgi|Phypa1_1|91945|fgenesh1_pg.scaffold_217000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]