SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI92155
Domain Number - Region: 698-793
Classification Level Classification E-value
Superfamily Acid proteases 0.000131
Family Retroviral protease (retropepsin) 0.046
Further Details:      
 
Domain Number - Region: 377-407
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0497
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92155
Sequence length 831
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFLGEVSGGESSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKAL
QAVINKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATMSEIKDHITSITDRCG
NSWEDFSHALKDEYFLEDADHVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKGTLF
TVNGSLKGKNGGEGLDDDFSHALKDEYFLEDADHVTKKLFLGWIERPNKNLQATELLREF
ERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVG
LLTKKEKRKDRSNISKTVQAPKTPVRTTPPTMPTVQPSTSLSKKTDMGMEEIIRGMRDLQ
IKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDEKIA
LKDRKDLLQTNFGKGGMRALVQDYLKEHETVVLESASYGAKVDDEIGGSTETSEFWTSAV
STMQEGKLSREALLRTAAIIRGRTVHAYIAKSQHEALMEEKRRENFDDTREGNSFKRQTR
GDKAREAASQELPVKDTLASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNA
KVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRHEEEVDIGYKQPI
NEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVALVDHGSEIN
LMSKDLYKKRKWPIDMEHRWAIRAANNTRGELYRACPDVKIWIGDVATEQHFFVQDTTSY
PLILGQPYITATRMETKVLDDGSAYARQEDESDMDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9TFP0
XP_001777452.1.60028 jgi|Phypa1_1|92155|fgenesh1_pg.scaffold_221000002 3218.JGI92155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]